PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00482g09010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 511aa    MW: 56343.9 Da    PI: 8.0105
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00482g09010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-393697263
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                              +e+++kcprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Niben101Scf00482g09010.1 36 PEQSQKCPRCDSSNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 97
                              67899*****************************************************9875 PP

2zf-Dof45.41.7e-142873133763
                    zf-Dof  37 rryWtkGGalrnvPvGggrrknkksss 63 
                               rryWtkGG+lrnvPvGgg+rknk+sss
  Niben101Scf00482g09010.1 287 RRYWTKGGTLRNVPVGGGCRKNKRSSS 313
                               9**********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.7E-333894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3114094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-254493IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-7287309IPR003851Zinc finger, Dof-type
PfamPF027016.8E-9287310IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MDPSNGQHHH QELSSQTLES MLVSTKPQQD KKPKPPEQSQ KCPRCDSSNT KFCYYNNYSL  60
SQPRYFCKSC RRYWTKGGTL RNVPVGGGCR KNKRSSSRST SQDHSINTNA NNALSSLTTP  120
MSYDSSDLSL AFARLQKQGH GHLGIENHNI SFMRNGTNIA PSQIQSGYFD ALRAGLLENP  180
NGFHQNLYYE VGNMGHHVEN GGMGLSNISD QENGSMHYDQ EINSGVTTTT ATTVTTVKQE  240
MCSMARDQGD NRVLWGFPWQ INNGDGNMGT DFDSSRSIWN GVGVFARRYW TKGGTLRNVP  300
VGGGCRKNKR SSSRSTSQDH SINTNANNAL SSLTTPMSYD SSDLSLAFAR LQKQGHGHLG  360
IENHNISFMR NGTNIAPSQI QSGYFDALRA GLLENPNGFH QNLYYEVGNM GHHVENGGMG  420
LSNISDQENG SMHYDQEINS GVTTTTATTV TTVKQEMCSM ARDQGDNRVL WGFPWQINNG  480
DGNMGTDFDS SRSIWNGVGV FARSLPYGLT N
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00392DAPTransfer from AT3G45610Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622795.10.0PREDICTED: dof zinc finger protein DOF2.1-like
RefseqXP_016492247.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLK4C9Q21e-112K4C9Q2_SOLLC; Uncharacterized protein
STRINGSolyc06g075370.2.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.18e-33TARGET OF MONOPTEROS 6